SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501435913|ref|YP_007984707.1| from Candidatus Saccharimonas aalborgensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501435913|ref|YP_007984707.1|
Domain Number 1 Region: 231-424
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.71e-58
Family B3/B4 domain of PheRS, PheT 0.000019
Further Details:      
 
Domain Number 2 Region: 36-221
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.81e-28
Family Myf domain 0.0066
Further Details:      
 
Domain Number 3 Region: 502-724
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.96e-19
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0016
Further Details:      
 
Domain Number 4 Region: 435-510
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000275
Family Domains B1 and B5 of PheRS-beta, PheT 0.0035
Further Details:      
 
Domain Number 5 Region: 738-836
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.0000000000131
Family Anticodon-binding domain of PheRS 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501435913|ref|YP_007984707.1|
Sequence length 838
Comment Phenylalanine--tRNA ligase beta subunit [Candidatus Saccharimonas aalborgensis]
Sequence
MKVSLNLIKQFTSINILVDELVATINNQLGGVEEVTELGVRYKNITIVKVVSCEKHPNAD
KLSVCKIDDGQSVRDVDRDVDGYVQVVCGAPNVHANMWAVWLPPHTTVPASYADAKPFVL
EPREIRGVMSNGMLGAGDELAINSDHNGIIELREEDMPPHIGARGLATGQDFAEAMGLDD
TIIDIENKMFTHRPDCFGQLGVAREIAGITGQPFHSPEWYTTLPSFLSANSFELTVTNQA
LTQVPRFMAVGFSGIEVKPSPLWLQCELIRLGSKAINNIVDVTNYVMLLTAQPTHAYDYD
KLRGHALSARMANSGEKVTLLNGKTYELGSDDIVIADQEGPVGLAGIMGGSNSEVSDTTT
SIVLEVATFDMYTVRKSSMRHGVFSDALTRFNKGQSPQQNPYVLNLLMMSIIDVAGGAQA
TEVVDAGQTITPSKAVVITPSFINNRLGLSLAKPQITTLLSNVEMRCDDEVSDDGDDAIV
VLPPYWRMDIEVPEDVVEEVGRLYGFDALPRELPKRAGGVATRNKNRVLKQRIRQSLARA
GANEVLTYSFVHEQVMKKAEQDASRAFRLGNAISPDLHLYRLSVLPSLLDKVHANIKNSY
DEFVLFEIGKGHDKVSHLADDNGLPSEPEFVDAVYASKKPRQGAAYYMMRRLVSQLAKDL
GLTLKLIPIDNADGIHAATVFAPARSARIESRQGEYIGIVGELKQSVRKAFKLPDYTAAM
TLELAGIANAVELKRNNYQPLSRYPSTSQDISLKTAFSVPYEKIFHCVWSAATEKMAGID
IRLEPVAVYSAEDNTDKKTTTLHITFTSYDKTLTDQTINPVMDHIASCAKDELAAERV
Download sequence
Identical sequences R4PLV8
gi|501435913|ref|YP_007984707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]