SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501436719|ref|YP_007985513.1| from Candidatus Saccharimonas aalborgensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501436719|ref|YP_007985513.1|
Domain Number 1 Region: 441-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.04e-16
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 
Weak hits

Sequence:  gi|501436719|ref|YP_007985513.1|
Domain Number - Region: 559-675
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0654
Family Poly A polymerase head domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501436719|ref|YP_007985513.1|
Sequence length 684
Comment membrane protein of unknown function [Candidatus Saccharimonas aalborgensis]
Sequence
MSRFFLPSFEGYKRRYVKSDLLAALVVTAIAVPESLGFAAIVGLPPQAGLYSALFAPIVF
AIFAHTRRLVVGADSATAALVASGAGLVAAAGSPDYTNAIVLLGLLTAVLLILMGVSKLG
FLADLISRPVLVGFLAGVGVQLILGKLPEMLGIEQSGNLLQKITGIIAHAGTINTMTVTI
SVLVVGLILILRHTRYPAELLALVAATILSSSFAVAAYGVKLVGALPAGLPTLTVPQFTP
GLIMTLFPAALAIALVILAQSSAVIRSQAAEHDDKIRLNTDLISLGFANAVSALTRGFAI
NGSPPRSQAADMAGGKTQLVNVYMSILIGLLLLFGSTLFVHMPVAALASVVCMVGFHLIR
VQELVYIWRAHRTEFFIAMIALVGVALLGVQQGVLIAVIVSLMERLSRQYRPKDDILLRD
GKLSDWAQQRIDSHHRFRSSPDGLLVYSFDGSLFFENISYFVSRLKAAIRTAKEPVRQVI
VDAGAIESIDYTAVEAMKQLHRHLGIDNITLGFAHVSPQLRTQFDEYGMTNLLGKEQIFP
TLNAAIEAHPGATRSVVEMVKRLELNSDHYVVIGGGVMEVLGLRTTRDTDLVVNDDIYRF
YRDEKGWKEYVQDNGKKILSHNGYNLMRSWMGRDLKALKKDAFQKDDVSFMSVKQLIECK
HHLGRKKDFADIELLNSSHHRRER
Download sequence
Identical sequences R4PWH7
gi|501436719|ref|YP_007985513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]