SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501677514|ref|YP_007997340.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501677514|ref|YP_007997340.1|
Domain Number 1 Region: 101-269
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.07e-40
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000372
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 2.53e-30
Family Shikimate dehydrogenase-like 0.0000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501677514|ref|YP_007997340.1|
Sequence length 273
Comment shikimate dehydrogenase AroE [Pseudomonas protegens CHA0]
Sequence
MDQYVVFGNPIGHSKSPLIHRLFAQQTGQQLEYNTLLAPLDDFAGTARSFFAHGRGANVT
VPFKEEAYRLCDSLTERAQRAGAVNTLSKQADGRLLGDNTDGAGLVRDLKVNAGVSLKGK
RILVLGAGGAVRGALEPLLAEQPEALVIANRTVEKAELLAELFADLGPVSASGFDWLQES
VDLIINATSASLSGELPPIAGSLIEAGKTVCYDMMYAKEPTPFCRWASEQGAALVLDGLG
MLAEQAAEAFYLWRGVRPDSAPVLAELRRQLAQ
Download sequence
Identical sequences A0A286ML24 A0A2C9EDW0
WP_015633620.1.100210 WP_015633620.1.11424 WP_015633620.1.12653 WP_015633620.1.1721 WP_015633620.1.21308 WP_015633620.1.27351 WP_015633620.1.41899 WP_015633620.1.462 WP_015633620.1.49818 WP_015633620.1.6225 WP_015633620.1.67749 WP_015633620.1.76749 WP_015633620.1.79484 gi|501677514|ref|YP_007997340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]