SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501677654|ref|YP_007997480.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501677654|ref|YP_007997480.1|
Domain Number 1 Region: 193-365
Classification Level Classification E-value
Superfamily vWA-like 3.53e-40
Family Integrin A (or I) domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501677654|ref|YP_007997480.1|
Sequence length 577
Comment hypothetical protein PFLCHA0_c01740 [Pseudomonas protegens CHA0]
Sequence
MSLPVHFLRPAAQGFAAGLLLAVAGCGVSSKPESAAGSSTQGALPQYEVQHADATMAKRA
VHPMRLSAPMPAPISSRDSLVAGYRDEPREQYQKLPDNPIHSVAEAPVSTFSADVDTGAY
ANVRRLLNQGSLPPEGAVRLEELVNYFPYDYALPTDGSPFGVTTELAPSPWNPHTRLLRI
GIKASDRAVAELAPANLVFLVDVSGSMDRREGLPLVKSTLKLLVDQLRDQDRVSLVVYAG
ESRVVLEPTSGRDKAKIRTAIDQLTAGGSTAGASGIQLAYQMAQQGFIDKGINRILLATD
GDFNVGVSDFDSLKAMAAEKRKSGVSLTTLGFGVDNYNEHLMEQLADAGDGNYAYIDNLR
EARKVLVDQLSSTLAVVAKDVKLQVEFNPAQVSEYRLLGYENRALKREDFSNDKVDAGEI
GAGHTVTALYEIVPAGEKGWLEPLRYAQAKAPQQSGKQGELAMLRLRYKAPEGGSSRLIE
RPISAQQPGSLAAASPDLRFAAAVAAFSQQLKDGRYTGNFSLADTVKLAQGAKGADPYGL
RGEFVQLVELAQSLQTQAPKAQAAQPVDLSQVQSRLE
Download sequence
Identical sequences A0A2C9EEA1
gi|501677654|ref|YP_007997480.1| WP_015633702.1.27351 WP_015633702.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]