SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501677671|ref|YP_007997497.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501677671|ref|YP_007997497.1|
Domain Number 1 Region: 390-631
Classification Level Classification E-value
Superfamily EAL domain-like 2.88e-90
Family EAL domain 0.0028
Further Details:      
 
Domain Number 2 Region: 217-375
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.84e-49
Family GGDEF domain 0.00021
Further Details:      
 
Domain Number 3 Region: 98-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.38e-29
Family Flavin-binding PAS domain 0.02
Further Details:      
 
Weak hits

Sequence:  gi|501677671|ref|YP_007997497.1|
Domain Number - Region: 10-73
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0772
Family ABC transporter transmembrane region 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501677671|ref|YP_007997497.1|
Sequence length 639
Comment hypothetical protein PFLCHA0_c01920 [Pseudomonas protegens CHA0]
Sequence
MSVSYRNGLRAALLYLLLSLVWLQFSGYLLSSFFDEFSDRAHWQLVGGYAWAVVSAVLIF
FARARLLRVLGADRWLRHQQKDRERLRQAAAVFDCTREGVLVSDTQGQIVHVNRAFIEIT
GYQREEVLGRQPSLFKSGHHSAQFYQSMFDSLQKTDEWSGEIWNRRKSGEIYPQWQTIRA
IRDEQGELTHYVAVFSDISAIKDSEHELAHLAHHDPLTDLPNRLLFTDRAEQALASAQIH
KRGCAMLMIDLDHFKMINDSLGHNVGDQLLKAVAERLGGMFGPGITLARLGGDEFAVLAE
SCPQLVQAAALAQRIIDGLKEPFQLGEQQVVINASIGISLFPSDALSASQLLRNADAALF
KAKSAGRNGYALYTEELTAHAQQRVEIAFELRRALDQQELRVYYQPVHDLKTSRLVGVEA
LVRWEHPERGLVSPAEFIPIAERTGMIAEIDAWVMQQACRQMCQWQADGVVLSFIAVNVS
TRLFARSELYQQVAQVLHETGLDPAYLELEVTESAVMDDPEVALEQMHRLRELGIRLAID
DFGTGYSSLLRLKRLPVQKLKIDQGFVAGLPFDEDDAAISRVIIALAQSMGMQVHAEGIE
QVEQARFLLEHACDLGQGYWFGRPMPAAQLVWSNAPQIR
Download sequence
Identical sequences A0A1K2BBW0 A0A2C9EEC2 A0A2K2WPJ7 Q4KK97
220664.PFL_0190 WP_011058570.1.100210 WP_011058570.1.101844 WP_011058570.1.11424 WP_011058570.1.12653 WP_011058570.1.14038 WP_011058570.1.1721 WP_011058570.1.18072 WP_011058570.1.21308 WP_011058570.1.23266 WP_011058570.1.27351 WP_011058570.1.38500 WP_011058570.1.39301 WP_011058570.1.41899 WP_011058570.1.42452 WP_011058570.1.42693 WP_011058570.1.462 WP_011058570.1.46426 WP_011058570.1.58641 WP_011058570.1.62026 WP_011058570.1.6225 WP_011058570.1.64508 WP_011058570.1.67749 WP_011058570.1.76749 WP_011058570.1.76969 WP_011058570.1.81001 WP_011058570.1.81277 WP_011058570.1.83211 gi|501677671|ref|YP_007997497.1| gi|70733696|ref|YP_257336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]