SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|501677908|ref|YP_007997734.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501677908|ref|YP_007997734.1|
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily HisI-like 7.19e-50
Family HisI-like 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501677908|ref|YP_007997734.1|
Sequence length 130
Comment phosphoribosyl-AMP cyclohydrolase [Pseudomonas protegens CHA0]
Sequence
MKDWLDQIKWDADGLVPAIAQDHKTGRVLMMAWMNREALSLTAAENRAIYWSRSRGKLWR
KGEESGHVQKLHEMRLDCDADVIILMVEQIGDIACHTGRHSCFYRVYEDGEWKTVEPVLK
DPHAIYSAGH
Download sequence
Identical sequences A0A1K2B412 A0A2C9EF07 A0A2K2WJX9 Q4KJL5
WP_011058799.1.100210 WP_011058799.1.101844 WP_011058799.1.11424 WP_011058799.1.12653 WP_011058799.1.14038 WP_011058799.1.1721 WP_011058799.1.18072 WP_011058799.1.21308 WP_011058799.1.23266 WP_011058799.1.27351 WP_011058799.1.38500 WP_011058799.1.39301 WP_011058799.1.41899 WP_011058799.1.42693 WP_011058799.1.462 WP_011058799.1.46426 WP_011058799.1.49818 WP_011058799.1.58641 WP_011058799.1.62026 WP_011058799.1.6225 WP_011058799.1.64508 WP_011058799.1.6649 WP_011058799.1.67749 WP_011058799.1.76749 WP_011058799.1.76969 WP_011058799.1.79484 WP_011058799.1.81001 WP_011058799.1.81277 WP_011058799.1.83211 WP_011058799.1.88821 220664.PFL_0424 gi|501677908|ref|YP_007997734.1| gi|70733928|ref|YP_257568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]