SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501677927|ref|YP_007997753.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501677927|ref|YP_007997753.1|
Domain Number 1 Region: 190-440
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.27e-82
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000209
Further Details:      
 
Domain Number 2 Region: 37-188
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 9.35e-51
Family Malic enzyme N-domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501677927|ref|YP_007997753.1|
Sequence length 450
Comment NADP-dependent malic enzyme MaeB [Pseudomonas protegens CHA0]
Sequence
MTGQSCGDYATRVSSAVRLSNSKKRNAHMSDLKTAALEYHANPRPGKLSVELTKATATAR
DLALAYSPGVAEPVREIARDPELAYKYTGKGNLVAVISDGTAILGLGNLGPLASKPVMEG
KGVLFKRFAGIDVFDIEVDSESPQAFIDTVKRISITFGGINLEDIKAPECFEIERALIEQ
CDIPVFHDDQHGTAIVTAAGMINALEIAGKTLADAKIVCLGAGAAAISCMKLLVSMGAQI
ENIFMVDRTGVIHSGRDDLNQYKAVFAHATDKRTLADALQGADVFVGLSGPNLLSAEGLK
SMAPNPIVFACSNPDPEIAPELAHATRDDVIMATGRSDYPNQVNNVLGFPFIFRGALDVR
AKRINEEMKIAAANALRDLAKLPVPQEVCDAYGGIKLEFGREYIIPKPMDARLITVISDA
VAKAAIETGVATLPYPKNYPLKSVDDVFNG
Download sequence
Identical sequences A0A2C9EF84
gi|501677927|ref|YP_007997753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]