SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501677976|ref|YP_007997802.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501677976|ref|YP_007997802.1|
Domain Number 1 Region: 11-98
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 1.96e-19
Family Cell division protein ZapA-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501677976|ref|YP_007997802.1|
Sequence length 100
Comment hypothetical protein PFLCHA0_c04990 [Pseudomonas protegens CHA0]
Sequence
MRHHIDGVKVVSILGEDYSIKAPAGEEQTLMDAALMLKAALADTKKKYPTLIGERLLVLA
AMNLCSQQIEMQKRHAQELERYQEQVSATVEVIAKTIQQN
Download sequence
Identical sequences A0A1K2B2U5 A0A2C9EFB5 A0A2K2WSI8 Q4KJE7
WP_011058865.1.100210 WP_011058865.1.101844 WP_011058865.1.11424 WP_011058865.1.12653 WP_011058865.1.14038 WP_011058865.1.1721 WP_011058865.1.18072 WP_011058865.1.21308 WP_011058865.1.23266 WP_011058865.1.27351 WP_011058865.1.38500 WP_011058865.1.39301 WP_011058865.1.41899 WP_011058865.1.42693 WP_011058865.1.462 WP_011058865.1.46426 WP_011058865.1.48506 WP_011058865.1.49818 WP_011058865.1.58641 WP_011058865.1.62026 WP_011058865.1.6225 WP_011058865.1.64508 WP_011058865.1.6649 WP_011058865.1.67749 WP_011058865.1.76749 WP_011058865.1.76969 WP_011058865.1.79484 WP_011058865.1.81001 WP_011058865.1.81277 WP_011058865.1.83211 WP_011058865.1.88821 gi|501677976|ref|YP_007997802.1| gi|70733996|ref|YP_257636.1| 220664.PFL_0492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]