SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678150|ref|YP_007997976.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|501678150|ref|YP_007997976.1|
Domain Number - Region: 137-196
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.00353
Family ABC transporter transmembrane region 0.033
Further Details:      
 
Domain Number - Region: 5-80
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0706
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501678150|ref|YP_007997976.1|
Sequence length 198
Comment membrane protein, MarC family [Pseudomonas protegens CHA0]
Sequence
MLHVLFSVYLKMLVLYSPFFVLSCFISLTRGYSLKERRRLAWKVALATLVSSILLYLFGR
VIFGVFGITVDAFRIGAGSVLFISALGMAQGKSAVQTDNVQQDVTIVPLTIPLTVGPGTI
GALLVMGVSQPHWDDKLTAILSIALASLTVGVVLYLSNRIERILGDQGLQIVSRLMGLFV
CALAAQIIFTGVRGYLVP
Download sequence
Identical sequences A0A1K2AW81 A0A2C9EFQ4 A0A2K4M3A3 Q4KIX8
220664.PFL_0663 gi|501678150|ref|YP_007997976.1| gi|70734165|ref|YP_257805.1| WP_011059033.1.100210 WP_011059033.1.101844 WP_011059033.1.11424 WP_011059033.1.12653 WP_011059033.1.14038 WP_011059033.1.1721 WP_011059033.1.18072 WP_011059033.1.21308 WP_011059033.1.23266 WP_011059033.1.27351 WP_011059033.1.38500 WP_011059033.1.39301 WP_011059033.1.41899 WP_011059033.1.42452 WP_011059033.1.42693 WP_011059033.1.462 WP_011059033.1.46426 WP_011059033.1.48506 WP_011059033.1.49818 WP_011059033.1.58641 WP_011059033.1.62026 WP_011059033.1.6225 WP_011059033.1.64508 WP_011059033.1.6649 WP_011059033.1.67749 WP_011059033.1.76749 WP_011059033.1.76969 WP_011059033.1.79484 WP_011059033.1.81001 WP_011059033.1.81277 WP_011059033.1.83211 WP_011059033.1.88821 GO.7177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]