SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678166|ref|YP_007997992.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501678166|ref|YP_007997992.1|
Domain Number 1 Region: 75-352
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.73e-66
Family Alanine racemase-like, N-terminal domain 0.00095
Further Details:      
 
Domain Number 2 Region: 459-567
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00000183
Family Eukaryotic ODC-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501678166|ref|YP_007997992.1|
Sequence length 637
Comment biosynthetic arginine decarboxylase SpeA [Pseudomonas protegens CHA0]
Sequence
MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINDAGRVEVRPNGPSSLPIDLFEQVE
ELRKSGLSLPLLVRFPDILQDRVRQLTGAFDANIGRLEYQSKYTALYPIKVNQQEAVIEN
IIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDREFIRLALMGQKLGHNVFIVI
EKESEVGLVIEEAASLKVKPQVGLRVRLSSLASSKWADTGGEKSKFGLSAAQLLSVVERF
RAAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRYYGELRNLGLPVDHIDVGGGLGVDY
DGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQSLPHPHIFSESGRSLTAHHAMLVVQVT
DVEKHNDDVPQIDNKQELPETVQWLVDLLGPTDIEMVTETYWRATHYMSDVAAQYADGKL
TLAEKALAEQCYFAVCRRLHNSLKARQRSHRQVLDELNDKLADKYICNFSVFQSLPDTWA
IGQVLPILPLHRLDEEPLRRAVLQDLTCDSDGKIKQYVDEQSIETSLPVHGLNEGEDYLL
GIFLVGAYQEILGDMHNLFGDTDSVNIYQRANGSVYHAGIETHDTIEDMLRYVHLSPEEL
MTHYRDKVASAKISAAERTQFLDALRLGLTRSSYLSS
Download sequence
Identical sequences A0A2C9EFV2 A0A2K2WR93 Q4KIW2
gi|501678166|ref|YP_007997992.1| gi|70734181|ref|YP_257821.1| 220664.PFL_0679 WP_011059048.1.100210 WP_011059048.1.11424 WP_011059048.1.12653 WP_011059048.1.14038 WP_011059048.1.1721 WP_011059048.1.18072 WP_011059048.1.21308 WP_011059048.1.27351 WP_011059048.1.39301 WP_011059048.1.41899 WP_011059048.1.42693 WP_011059048.1.462 WP_011059048.1.46426 WP_011059048.1.6225 WP_011059048.1.64508 WP_011059048.1.67749 WP_011059048.1.76749 WP_011059048.1.81001 WP_011059048.1.81277 WP_011059048.1.83211 WP_011059048.1.88821 NYSGRC-FDAO-AAY96086 PlR130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]