SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678343|ref|YP_007998169.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501678343|ref|YP_007998169.1|
Domain Number 1 Region: 645-934
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.62e-100
Family Pyruvate phosphate dikinase, C-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 4-141
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.96e-35
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00012
Further Details:      
 
Domain Number 3 Region: 518-633
Classification Level Classification E-value
Superfamily Phosphohistidine domain 7.72e-32
Family N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system 0.06
Further Details:      
 
Domain Number 4 Region: 428-536
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 2.35e-26
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.00091
Further Details:      
 
Domain Number 5 Region: 285-372
Classification Level Classification E-value
Superfamily HPr-like 4.06e-18
Family HPr-like 0.00098
Further Details:      
 
Domain Number 6 Region: 148-275
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 3.14e-16
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501678343|ref|YP_007998169.1|
Sequence length 953
Comment fruB(HI): multiphosphoryl transfer protein [Pseudomonas protegens CHA0]
Sequence
MLELTVEQISMGQSAVDKSAALHLLADKLVADGLVAEGYLAGLQAREAQGSTFLGQGIAI
PHGTPETRDQVFATGVRLLQFPDGVDWGDGQIVYLAIGIAAKSDEHLRLLQLLTRALGET
DLGQALRRASSPQALLKLLQGAPQELALDAQMIGLGVAAEDFEELVWRGARLLRQAECVS
NGFAAVLQQVEALPLGDGLWWLHSEQTVLRPGLAFVTPDKPIRYLGQPLSGLFCLASLGE
AHQALLERLCALLIEGRGQELGRATSSRAVLEVLGGELPADWPSARIALANAHGLHARPA
KVLAQLAKNFEGEIRIRIVDGKDSAVSVKSLSKLLSLGARRGQVLELIAEPSIAADALPA
LLAAIEEGLGEEVEPLPAVSTPRQAPQEVVEPLSAPASGSLIQAIAAAPGIAIGPAHIQV
QQSIDYPLRGESTAIERQRLQQALAEVREDIQGLIQRSQAKAIREIFITHQEMLDDPELS
DEVDTRLKQGESAEAAWMTVIESAAKQQEALQDALLAERAADLRDIGRRVLAQLCGIETP
AEPDQPYILVMDEVGPSDVARLDPTRVAGILTARGGATAHSAIVARALGIPALVGAGASV
LLIKSGTSLLLDGQRGRLHVDADSTTLQRAAEERDNREQRLKAAAEQRHQLAHTADGHAV
EVFANIGESAGVAAAVENGAEGIGLLRTELIFMAHPQAPDEATQEAEYRRVLDGLAGRPL
VVRTLDVGGDKPLPYWPIAKEENPFLGVRGIRLTLQRPLIMEAQLRALLRSADNRPLRIM
FPMVGSVEEWRQARDMTERLRREIPVADLQLGIMIEVPSAALLAPVLAKEVDFFSIGTND
LTQYTLAIDRGHPTLSAQADGLHPAVLQLIDITVRAAHAHGKWVGVCGELAADPLAVPVL
VGLGVDELSVSGRSIAEVKARIRELRLAQAQTLAQQALAVGSANEVRALVEAM
Download sequence
Identical sequences A0A2C9EGB0
gi|501678343|ref|YP_007998169.1| WP_015634131.1.27351 WP_015634131.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]