SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678345|ref|YP_007998171.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501678345|ref|YP_007998171.1|
Domain Number 1 Region: 122-219
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.03e-34
Family PTS system, Fructose specific IIB subunit-like 0.00023
Further Details:      
 
Domain Number 2 Region: 2-102
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.83e-24
Family PTS system, Fructose specific IIB subunit-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501678345|ref|YP_007998171.1|
Sequence length 581
Comment PTS system fructose-specific EIIBC componentFruA [Pseudomonas protegens CHA0]
Sequence
MKLAIVTACPNGMVTSVLCARLLDAAAQRQGWSTSVEVHDEAHPERQLSAATIEAAEWVL
VVSTGPVDMSRFVGKRVYRSSPSQALQDVDAVLRRGAEEAQVHVATEASAEPVLETGKRA
PRLVAITACPTGVAHTFMAAEALQQTAKRLGYDLQVETQGSVGARNPLSAQAIAEADVVL
LAADIEVPTERFAGKRIYRCGTGVALKQSEATLNKALAEGRLESSVAGAQAPAKQEKTGV
YKHLLTGVSFMLPMVVAGGLMIALSFVFGITAFKEEGTLAAALMQIGGETAFKLMVPLLA
GYIAYSIADRPGLAPGMIGGMLASTLGAGFIGGIVAGFLAGYAAKAINKYARLPQSLEAL
KPILIIPLLASLFTGLVMIYVVGKPVAGMLEALTHFLDSMGTTNAILLGVLLGGMMCVDL
GGPINKAAYAFSVGLLASQSYAPMAATMAAGMVPPIGLGIATFIARRKFAQTEREAGKAA
LVLGLCFISEGAIPFAAKDPLRVIPASIAGGALTGALSMYFGCKLMAPHGGLFVMLIPNA
INHALLYLLAIVAGSLLTAVVYALVKRPETVELALEPAKAA
Download sequence
Identical sequences A0A2C9EG93
WP_015634132.1.27351 WP_015634132.1.42452 WP_015634132.1.76749 gi|501678345|ref|YP_007998171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]