SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678395|ref|YP_007998221.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501678395|ref|YP_007998221.1|
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily HPr-like 1.14e-24
Family HPr-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501678395|ref|YP_007998221.1|
Sequence length 90
Comment phosphocarrier protein HPr [Pseudomonas protegens CHA0]
Sequence
MPALEIEIINKLGLHARASAKFVGVAGQFPCQIRAGRTPDSMVDGKSIMAMMMLAAGKGT
RIHLKTEGEQEQEAMDALVALINNFFDEGE
Download sequence
Identical sequences A0A1K1XZ54 A0A2C9EGD9 A0A2K4M2N8 Q4KI91
WP_011059265.1.100210 WP_011059265.1.101844 WP_011059265.1.11424 WP_011059265.1.12653 WP_011059265.1.14038 WP_011059265.1.1721 WP_011059265.1.18072 WP_011059265.1.21308 WP_011059265.1.23266 WP_011059265.1.27351 WP_011059265.1.38500 WP_011059265.1.39301 WP_011059265.1.41899 WP_011059265.1.42452 WP_011059265.1.42693 WP_011059265.1.462 WP_011059265.1.46426 WP_011059265.1.49818 WP_011059265.1.58641 WP_011059265.1.62026 WP_011059265.1.6225 WP_011059265.1.64508 WP_011059265.1.67749 WP_011059265.1.76749 WP_011059265.1.76969 WP_011059265.1.81001 WP_011059265.1.81277 WP_011059265.1.83211 WP_011059265.1.88821 gi|70728293|ref|YP_258042.1| 220664.PFL_0911 gi|501678395|ref|YP_007998221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]