SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678461|ref|YP_007998287.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501678461|ref|YP_007998287.1|
Domain Number 1 Region: 138-335
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.89e-44
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000377
Further Details:      
 
Domain Number 2 Region: 2-135
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 3.01e-37
Family Aminoacid dehydrogenases 0.0000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501678461|ref|YP_007998287.1|
Sequence length 339
Comment leucine dehydrogenase YqiT [Pseudomonas protegens CHA0]
Sequence
MFALMHSTRLESLHLSVDPCTGLKAVIAIHDSRLGPALGGCRYLAYPDDSSAVTDAARLA
QGMSYKAALAGLPQGGGTAVIIRPAHVESRAALFEAFGRCVEQLDGRYITAIDSGTSVAD
MDCIAQQTRYVTSTSAAGDPAPHAAMGVFAGIRSTAMARLGSDNLEGLRVAIQGLGNVGY
ALAEQLHAAGAELLVSDIDAGKVQLAMEQLGAHPIANDSLLSTPCDILAPCGLGAVLNSL
SVAQLRCSAVAGSANNQLTNLQVADQLERRGILYAPDYVINSGGLIYVSLKHRNTELPVI
TAHLSKISQRLTEIFAHAQAEKRSPARVADELAERVLYR
Download sequence
Identical sequences A0A1K1XUS8 A0A2C9EGK4 A0A2K2WV78 Q4KI29
220664.PFL_0973 gi|70728355|ref|YP_258104.1| WP_011059327.1.101844 WP_011059327.1.11424 WP_011059327.1.12653 WP_011059327.1.14038 WP_011059327.1.1721 WP_011059327.1.18072 WP_011059327.1.21308 WP_011059327.1.23266 WP_011059327.1.27351 WP_011059327.1.38500 WP_011059327.1.39301 WP_011059327.1.41899 WP_011059327.1.42452 WP_011059327.1.42693 WP_011059327.1.462 WP_011059327.1.46426 WP_011059327.1.48506 WP_011059327.1.49818 WP_011059327.1.58641 WP_011059327.1.62026 WP_011059327.1.6225 WP_011059327.1.64508 WP_011059327.1.67749 WP_011059327.1.76749 WP_011059327.1.76969 WP_011059327.1.81001 WP_011059327.1.81277 WP_011059327.1.83211 WP_011059327.1.88821 gi|501678461|ref|YP_007998287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]