SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678569|ref|YP_007998395.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501678569|ref|YP_007998395.1|
Domain Number 1 Region: 523-815
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 3.4e-97
Family Pyruvate phosphate dikinase, C-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 3-153
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 2.09e-48
Family Glucose permease-like 0.00014
Further Details:      
 
Domain Number 3 Region: 399-515
Classification Level Classification E-value
Superfamily Phosphohistidine domain 1.96e-27
Family N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system 0.03
Further Details:      
 
Domain Number 4 Region: 308-417
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 5.1e-25
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.0017
Further Details:      
 
Domain Number 5 Region: 175-253
Classification Level Classification E-value
Superfamily HPr-like 6.54e-17
Family HPr-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501678569|ref|YP_007998395.1|
Sequence length 840
Comment fruB(HI): multiphosphoryl transfer protein [Pseudomonas protegens CHA0]
Sequence
MHNNNNELTLGAPLSGPVLALRSVPDPVFASGAMGDGIAIDPLNDTLHAPCAGQVIQVAR
TGHAITLRAANGAELLLHLGLDTVELQGEGFALLVKEGQQVRAGQPLLRVDLDHVAQHCR
SLISLLILTNGEGFDLRPLTLSTVQVGEPLLHISRRANAGPQPLAQEQSGQQASARIKVA
HRGGLHARPAALVRQTALSFNSHSQLTFKDKSAPCTSLIALMSLGIGEQEEVLVSCQGDD
CQDALQAMLQTLGTAMAADAHGETPVPAPAAQGPVEDGVLPGVCAAPGLVCGPLVRLNAM
VLAEDHGQHAPEPQRQALSTALDQVRGEIRHTLEQARQRRDQQEQDIFSAHLALLEDPTL
LDAAEASIAQGRAATHAWSAAITEQCQILQQLGSTLLAERANDLRDLQQRVLRALLGEAW
HYDLPAGAIVAAEELTPSDLLQLSAQGVAGLCMAAGGATSHVAILARGKGLPCLVALGPQ
VLRIDSGRQVVLDANGGRLELEPDPQRIAQVQRAGETQRQRHALQQQKAHEPALTQDGQQ
IEVAANVASSDEARDAHQGGADGVGLLRTEFLFVDRQTAPDQEEQRQAYQAVLNAMGDKP
VIIRTIDVGGDKQLDYLPLPVEANPVLGLRGIRLAQARPELLDQQLRALLQVSPVQRCRV
MLPMVTEVAELLHIRQRLDLFAAELGLNQRPELGVMIEVPAAALMAEQLAEHADFLSIGT
NDLSQYTLAMDRDHAGLAARVDALHPALLRLIAQTCAGAQRHGRWVGVCGALASDPLATP
VLIGLGVSELSVSPPQVGEIKDRVRQLDASQCRQLSQPLLNLPGAAAVRQACERLWPLHS
Download sequence
Identical sequences A0A2C9EGV7
gi|501678569|ref|YP_007998395.1| WP_015634271.1.27351 WP_015634271.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]