SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678626|ref|YP_007998452.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|501678626|ref|YP_007998452.1|
Domain Number - Region: 25-87
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.00497
Family ABC transporter transmembrane region 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501678626|ref|YP_007998452.1|
Sequence length 171
Comment hypothetical protein PFLCHA0_c11560 [Pseudomonas protegens CHA0]
Sequence
MERTLSDSQIRYIKARERRNLRGAQAFICLFLSLFVLILLQGVWLLISPQLACALLVPWA
IFLWWWVLHRLKGQQSEVAARTQWLQGQFSATWVSSHRNGHFSYSFGDYPIAACCRLNNL
FNEKRLDLHTRYRVEAALLTCSQTASHSYYLFGDTLVTVPRDPATDEQPGS
Download sequence
Identical sequences A0A2C9EH68 A0A2K2WVQ2
WP_015634307.1.100210 WP_015634307.1.11424 WP_015634307.1.12653 WP_015634307.1.1721 WP_015634307.1.21308 WP_015634307.1.27351 WP_015634307.1.41899 WP_015634307.1.462 WP_015634307.1.6225 WP_015634307.1.67749 WP_015634307.1.76749 gi|501678626|ref|YP_007998452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]