SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678875|ref|YP_007998701.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501678875|ref|YP_007998701.1|
Domain Number 1 Region: 113-850
Classification Level Classification E-value
Superfamily Porins 6.54e-88
Family Ligand-gated protein channel 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|501678875|ref|YP_007998701.1|
Domain Number - Region: 9-69
Classification Level Classification E-value
Superfamily EscU C-terminal domain-like 0.0379
Family EscU C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501678875|ref|YP_007998701.1|
Sequence length 853
Comment TonB-dependent heme receptor A [Pseudomonas protegens CHA0]
Sequence
MFRALLPVPLVRTRPTLLAACLAFSLQAYAGPLHFQLPAQPLAASLSQIAQQAKIQLLFD
EQLLRNAKAPALQGDYSPEEAIRTLLQDGRFNLVKVDNTYIVRPADTNLSSGSALQLGAM
SVIGNGTEVDSSSVGRSTLNQAEIDRHQATNVVSLIDTLPGVSLGGSLKPGGQTINIWGL
GDAEDVPMSVDGATKSGFERYQQGSVFIEPELIKRIEVEKGPHSPETGNGGFGGTVHMET
KDAPDLLQEGRNAGAMVKYGYSSNSHEQAYTGAVYGRTDDHRFDALAYWTKRDGDDMKIA
SAQPDPRNAYPINPKRLPNTAQDMEGELFKLNMQLTDEHRLGFSYMRSNSDIWAPFSAKS
YPTPPSQSDINKYGYDGATRRFLAQRNTIDTTWIAKYQYTPVDNPWIDFEAKYSDSTTDQ
TDERGPNAFFQPASGGRKITVGYDDKILALKNTSRFSTGPLEHALTNGIQIRKHTREVDM
WMPGKTYEVPKYNYGHYQPGFMPHGKVDNNAFYIQDAITLGNFTLTPSLRYDHVRNRGEK
NDAPFYNSPDPVAGHDYGDKTYTGWSPRLSAFWTVTPQFALFADYSKTWRAPVIDEQYEV
QSAASTRSATSRDLDPERITALRAGNITSFSDVFTQADRVQVRTTLFHNTIKDEIMKNLG
IGCPEQLSSGKSIGQVCNQPTIGVYRNIGDLTIKGFEVESFYDSTYLFGSLSYSWITGKH
EGAYTNPWGPNVWARDIPPRKWVASLGVKIPQWDAQVGWQGQWVRQTDRVPSDIYAGGPA
SALGDAYWDQYKNDRYNVHGLFANWKPQQPYLKGTEVNFTLDNMFNRDYRPPLSGDNASS
LGRNAKISVTRFF
Download sequence
Identical sequences A0A2C9EHS4
gi|501678875|ref|YP_007998701.1| WP_015634461.1.27351 WP_015634461.1.42452 WP_015634461.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]