SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501679046|ref|YP_007998872.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501679046|ref|YP_007998872.1|
Domain Number 1 Region: 352-602
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.57e-88
Family ABC transporter ATPase domain-like 0.000000805
Further Details:      
 
Domain Number 2 Region: 29-343
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 2.88e-48
Family ABC transporter transmembrane region 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501679046|ref|YP_007998872.1|
Sequence length 610
Comment ABC transporter ATP-binding protein HI [Pseudomonas protegens CHA0]
Sequence
MLFRRFEQLIDIFRDAPSATPPNRVLPFYFHYIKQVWPSFVALLVVGLFVALIEVSLFSY
LSTIIDLAQGTPSVQVFTDHGLELAWMAVVALLFRPLMVGLHDLLMHQTINPGMTSLIRW
QNHSYVLRQSLNFFQNDFAGRIAQRIMQTGYSLQDSSVQVIDALWHVTIYAIGSLVLFAD
ADWRLMIPLLLWIAGFIGAMRYFVPRIQKRSVDASDARSKLMGRIVDGYTNITTLKLFAH
THFEQSYAREAIAEQTEKSQLAGRVVTAMDVTITSLNGLLIAGTTGLALWLWSQSLISAG
AIALATGLVIRIVNMSGWIMWVINGIFENIGMVEDGLKTIAQPLQLTDREQAPKLAVAQG
GVRFEHVEFHYGKANRVISDLNLEIRPGEKIGLIGPSGAGKSTLVNLLLRLYDLQGGKIL
IDGQDIAGVTQESLRERIGMITQDTSLLHRSIRDNLLYGRPDATDEELWEAVRKARADEF
IPLLSDAQGRTGFDAHVGERGVKLSGGQRQRIAIARVLLKDAPILIMDEATSALDSEVEA
AIQESLETLMQGKTVIAIAHRLSTIARMDRLVVLEQGRIAETGTHAELLAHGGLYARLWQ
HQTGGFVGID
Download sequence
Identical sequences A0A2C9EIF7 A0A2K4LUL6
WP_015634574.1.27351 WP_015634574.1.76749 gi|501679046|ref|YP_007998872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]