SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501679159|ref|YP_007998985.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501679159|ref|YP_007998985.1|
Domain Number 1 Region: 245-352
Classification Level Classification E-value
Superfamily EscU C-terminal domain-like 1.02e-38
Family EscU C-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501679159|ref|YP_007998985.1|
Sequence length 378
Comment flagellar biosynthetic protein FlhB [Pseudomonas protegens CHA0]
Sequence
MAESESGQDKTEEPTEKRKKDSREKGEIARSKELNTLAIMLAGAGGLLVYGGGLALDLLE
IMRLNFSLPREVLLSPGAMGLYLLHSGKIAILAVQPVLLTLLLAAVIGPISLGGWLFAGK
SLAPKFSRMNPANGLKRMFSPTALIELLKALAKFALVLFVALSVLSADIDDLLRIAHEPL
EKAIIHSIQVVGWSTLWMACGLILIAAVDVPVQLYQAHKKLLMTKQEVRDEHKDQEGRPE
VKQRIRQLQREMSQRRMMAAIPEADVVITNPTHYAVALKYDAEKGGAPVLLAKGSDFLAL
QIREIAVAHEVMLLESPALARSIFYSTELEEEIPAGLYLAVAQVLAYVYQIRQHRAGKGK
RPDPLKDLPIPPDLQRDS
Download sequence
Identical sequences A0A2C9EIL4 A0A2K2WXA5
WP_015634638.1.100210 WP_015634638.1.12653 WP_015634638.1.27351 WP_015634638.1.42452 WP_015634638.1.76749 WP_015634638.1.88821 gi|501679159|ref|YP_007998985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]