SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501679182|ref|YP_007999008.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501679182|ref|YP_007999008.1|
Domain Number 1 Region: 6-84
Classification Level Classification E-value
Superfamily EscU C-terminal domain-like 1.27e-21
Family EscU C-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501679182|ref|YP_007999008.1|
Sequence length 109
Comment FlhB domain protein FlhB [Pseudomonas protegens CHA0]
Sequence
MKHSPPPRQAIALKYDGQQAPTLTAKGDDELAEAILKIARDYEVPIYENAELVKLLARLE
LGESIPPELYRTIAEIIAFAWNLKGKFPAGHDPQRAELEKDVTERGDDY
Download sequence
Identical sequences A0A1K1Z8C2 A0A2C9EIN9 A0A2K2WWL8 Q4KG29
220664.PFL_1678 gi|501679182|ref|YP_007999008.1| WP_011060013.1.100210 WP_011060013.1.101844 WP_011060013.1.12653 WP_011060013.1.14038 WP_011060013.1.18072 WP_011060013.1.23266 WP_011060013.1.27351 WP_011060013.1.38500 WP_011060013.1.39301 WP_011060013.1.42452 WP_011060013.1.42693 WP_011060013.1.46426 WP_011060013.1.58641 WP_011060013.1.62026 WP_011060013.1.64508 WP_011060013.1.76749 WP_011060013.1.76969 WP_011060013.1.81001 WP_011060013.1.81277 WP_011060013.1.83211 gi|70729068|ref|YP_258804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]