SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|501679661|ref|YP_007999487.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501679661|ref|YP_007999487.1|
Domain Number 1 Region: 284-334
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000448
Family AraC type transcriptional activator 0.023
Further Details:      
 
Weak hits

Sequence:  gi|501679661|ref|YP_007999487.1|
Domain Number - Region: 251-296
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.00384
Family Porin chaperone SurA, peptide-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501679661|ref|YP_007999487.1|
Sequence length 338
Comment transcriptional regulator, AraC family [Pseudomonas protegens CHA0]
Sequence
MRESDSVAVYFVRVMTHALRQQPARLAAVLREAGIDPALLDQPRARVPGSAFAALWLIQI
RELQDEFFQLDSRGMPPGAFALICRGLIQEPNLEKALRQCLNNFGLFLRDVGASLSLRGK
RAVISLDSRCADPLRSHYAEETLLVLVISLLCWLGGRRIPIDRADFRHSRLSLSDDALLW
GSNLSWNAGRTEIEFASRFLRLPVVQDLASLKVFLRSAPQWLVIRFRNQHGLTTQVHQRL
RGSHYSQWPTLEAFAREVQMSASTLRRRLEREGGSYQEIKDEVRRGVAVELLRRSAASIS
EIAELTGFQEPSAFHRAFKKWTGESPGRYRARFQPAPA
Download sequence
Identical sequences A0A2C9EJZ4
gi|501679661|ref|YP_007999487.1| WP_015634955.1.27351 WP_015634955.1.76749 WP_015634955.1.88821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]