SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501679817|ref|YP_007999643.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501679817|ref|YP_007999643.1|
Domain Number 1 Region: 10-318
Classification Level Classification E-value
Superfamily TROVE domain-like 3.14e-72
Family TROVE domain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 320-500
Classification Level Classification E-value
Superfamily vWA-like 8.53e-38
Family RoRNP C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501679817|ref|YP_007999643.1|
Sequence length 514
Comment 60 kDa SS-A/Ro ribonucleoprotein [Pseudomonas protegens CHA0]
Sequence
MANFQLFNTQQAKAPASTTLNASKAGAYAYNAKHRLAQLAVTGCLNSTFYTSPEGQLEAV
LQLVSELDSRFVAQAARYARQQGHMKDMPALLLAALTAQRSALVPELFAQVVDNGKMLRN
FVQILRSGVTGRKSLGSQPKRLVQNWLNSATERQLLQASIGNQPSLADVVKMVHPKPSEA
WREAFFAWLIGKPVDVQALPELTRDLLAFRSGATREVPQVPFQLLGNETLSTEQWAGQAR
NMGWQGLRMNLNTLARHGAFQVPGCTEYVAARLADAGEAAKARVYPYQLLAAYRMAGDEV
PQPVREALQDALELSLANVPALAGNVVVCPDVSGSMHSPVTGYRQGATTAVRCIDVAALV
AAAVLRKQPAARVMPFERGVVNIHLNPRDSVMSNAQKLANIGGGGTNCSAPLAQLANAKS
RVDTLILVSDNESWIDARRHGATETMRQWERIRAINPQAKLVCIDMQPGATTQAPDREDI
LNVGGFSDAVFDVIEQFTAGNYGAQHWVKAIEAM
Download sequence
Identical sequences A0A2C9EKL7
WP_015635087.1.27351 WP_015635087.1.76749 gi|501679817|ref|YP_007999643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]