SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501679832|ref|YP_007999658.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501679832|ref|YP_007999658.1|
Domain Number 1 Region: 18-268
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.93e-59
Family Alanine racemase-like, N-terminal domain 0.0000000326
Further Details:      
 
Domain Number 2 Region: 240-407
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.03e-53
Family Eukaryotic ODC-like 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501679832|ref|YP_007999658.1|
Sequence length 410
Comment diaminopimelate decarboxylase LysA [Pseudomonas protegens CHA0]
Sequence
MAIPFSPAQLVAAARQYGTPLWCYDAATIQARIAQLQAFDVVRYAQKASSNLHLLRLIRE
AGVRVDAVSLGEIERALLAGFSPVDAGIVFTCDLFDEATLARVVELQVEVNAGSIDMLRQ
LGEKSPGHRVWLRINPGFGHGHSRKTNTGGENSKHGIWHDQMSEALAVIRQHGLHLVGLH
MHIGSGVDYDHLEQVGAAMVAAVKSLDHDLEAFSIGGGLSTPYREGDTPVDVQRYANAWK
VARQEIEAYLGHGVRMEIEPGRFLVAEAGCLVSEVRVVKTAGQHHFVLVDTGFNDLMRPA
MYGAYHGMSLLDAAGHPVERPQQLTVVGGPLCESGDIFTQDDECLTPRPLPQARVGDLLV
LHDTGAYGASMSSNYNSRPLLPEVLFENGQPKLIRRRQPLADLLALELGL
Download sequence
Identical sequences A0A2C9EKI5 Q4KEA8
gi|501679832|ref|YP_007999658.1| 220664.PFL_2318 gi|70729686|ref|YP_259425.1| NYSGRC-FDAO-AAY91591 WP_011060616.1.14038 WP_011060616.1.18072 WP_011060616.1.27351 WP_011060616.1.39301 WP_011060616.1.42452 WP_011060616.1.42693 WP_011060616.1.46426 WP_011060616.1.48506 WP_011060616.1.64508 WP_011060616.1.6649 WP_011060616.1.76749 WP_011060616.1.81001 WP_011060616.1.81277 WP_011060616.1.83211 WP_011060616.1.88821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]