SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501680242|ref|YP_008000068.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501680242|ref|YP_008000068.1|
Domain Number 1 Region: 375-449
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000228
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 2 Region: 94-271
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000303
Family Integrin A (or I) domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501680242|ref|YP_008000068.1|
Sequence length 580
Comment TPR domain protein [Pseudomonas protegens CHA0]
Sequence
MISLWPHWFRPGWLLVLPLLALLLWKLWHRQKRAGRWQMILPPAFHAALLSGGNGRESKL
PWVALGLAWLLAVLALLGPSWQRVEQTSQKPADPLVVLLELTPQMLANDVPPDRLEQARH
KLLDLLQLRSDAQTAIVVYAGSAHTLVPLSDDLATSRNLLDALKPSIMPQAGQRADLALL
KALKLLDQGALGQGRVLLMASSLNEEERQGIRQALKGDAPQLLMLGFGSRDGAPVAQEDG
SYLKDDQGAILVSRLDSPDLKHFIGDVGGRYRQARLDDSDLRGLGLLGGPQGLRSDGQTL
RLDTWADQGYWLLLPLLLLAACAGRRGWLFCLPLLLFAVPQPSYAFDFNDLWLRPDQQGQ
RLLQQQRPAEAARHFQDPQWQGVALYEAGNYTAAAERFAEGNDALAHYNRGNALARSGEL
EAAIDAYEQALERQPDLQPALQNKALVESLLQQQQAQAQTPPPAKKPDTPEGDDTRPGPS
GAATQPPPGSNGPQAPAQTPANEGDTPPDPQAAGHSEVPGSELDDQHTTTPLRPVEDSLD
AEHQQALEQWLRKIPDDPGELLRRKFWYEQQQHQDQGKTR
Download sequence
Identical sequences A0A2C9ELN1
gi|501680242|ref|YP_008000068.1| WP_015635421.1.27351 WP_015635421.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]