SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501680575|ref|YP_008000401.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501680575|ref|YP_008000401.1|
Domain Number 1 Region: 24-157
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 8.89e-54
Family Ecotin, trypsin inhibitor 0.00000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501680575|ref|YP_008000401.1|
Sequence length 158
Comment ecotin [Pseudomonas protegens CHA0]
Sequence
MRLLPLASVTLLSALCAQAFAAKLEDTAPYPKAEDGFTRQVIHLPKQQHEDRYKVEILAG
KTLTVDCNLQRLGGKLLEKNLEGWGYPYYRLDQVSGPISTRMACPDGKTREDFVPVTGDG
FVLRYNSKLPIVIYAPKDVEVRYRLWSAADKTENARQE
Download sequence
Identical sequences A0A1K1U7B2 A0A2C9EMM7 A0A2K4LB92
gi|501680575|ref|YP_008000401.1| WP_015635680.1.101844 WP_015635680.1.23266 WP_015635680.1.27351 WP_015635680.1.38500 WP_015635680.1.39301 WP_015635680.1.46426 WP_015635680.1.48506 WP_015635680.1.58641 WP_015635680.1.62026 WP_015635680.1.64508 WP_015635680.1.76749 WP_015635680.1.76969 WP_015635680.1.81001 WP_015635680.1.81277 WP_015635680.1.83211 WP_015635680.1.88821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]