SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501680648|ref|YP_008000474.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501680648|ref|YP_008000474.1|
Domain Number 1 Region: 338-589
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-67
Family ABC transporter ATPase domain-like 0.0000111
Further Details:      
 
Domain Number 2 Region: 10-329
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 2.62e-57
Family ABC transporter transmembrane region 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501680648|ref|YP_008000474.1|
Sequence length 593
Comment putative multidrug export ATP-binding/permease protein YgaD [Pseudomonas protegens CHA0]
Sequence
MIEKHPLLRALAIYREVPWRFTLVALLYVAVNLGLVWQQWLIGHAVNDVSSGQAVKHLAD
GSLDASLGWYWLWLLLAVALGRGLLQYAATVLSLVLSQELLTRLRERILQQVQGLHLGYH
WQHGMGEMITRTTRDADKVRDALISFWRQVVETPLVVLATVGLLAWYSPWLAVVPLLLTA
CGLWIFVRQTEHLVSLDRAVGAAYDRVNQDLSEGIGGVRVIKSFALEHSRIQGFAAQVGL
FAEHARRALAYSSSRIPLPQAVVALSHVWILVYGAHQVAARQLGIGELVSALLIVTTLVF
RIEGIGRVMQTFADARSSAERIWQLLDEPLHIRSGNARLPQAPLGLRLEGVSVSAPGGGR
KILDDCSLSLEPGEVVALVGATGTGKSLLASLLPRLTEAGAGRVLLGSELSGWQDVRDLD
LQQLRRRVHVVPQESFLFSDTLAANLRLTAPDASHRQLRQGLALAAAEDVLERLPQGLDS
RLGDRGVTLSGGQRQRLSLARALLGEPDILCLDDATSALDAISERQVLDNIRQLRRDQGR
ATTLLVISSKLSTILLADRVLLLQDGRIRASGRHAELLKTNAHYRDLLGVDHG
Download sequence
Identical sequences A0A2C9EMS9
WP_015635729.1.27351 WP_015635729.1.76749 gi|501680648|ref|YP_008000474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]