SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501680686|ref|YP_008000512.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501680686|ref|YP_008000512.1|
Domain Number 1 Region: 320-554
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.3e-68
Family ABC transporter ATPase domain-like 0.0000219
Further Details:      
 
Domain Number 2 Region: 9-318
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 4.32e-46
Family ABC transporter transmembrane region 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501680686|ref|YP_008000512.1|
Sequence length 593
Comment alkaline protease secretion ATP-binding protein AprD [Pseudomonas protegens CHA0]
Sequence
MVKNNHPAPLFKALGEYKGILISVGCFTALINVLMLVPSIYMLQVYDRVLSSQNETTLVM
LSLMVVGFFVFIGLLEVLRSFIVIRIGSQLERRFNLRVYQAAFERNLSRGEGHAGQSLGD
LTHIRQFLTGPALFAFFDAPWFPIYLLVIYAFNVWLGVFATVGALLLIALAYLNEAMTKK
DLAEASGFSQRSTQLATSHLHNAETIQAMGMLGALRKRWFAVHSRFLGLQNQASDTGSVI
SSLSKTLRLCLQSLVLGLGALLVIKGDMTAGMMIAGSILMGRVLSPIDQLIAVWKQWSSA
KLAYGRLDALLREFPPSDTAMSLPAPKGQVSFEQVSAGPPGRRMATLQQVNFSINAGEVL
GVLGASGSGKSTLARVLVGVWPTLGGTVRLDGADIHRWNRDELGPYIGYLPQDIELFTGS
IAENIARFRQADPEQVVQAAQMAGVHELILRLPQGYDTVLGDDGSGLSGGQKQRVALARA
LYGSPSLVVLDEPNSNLDTVGESALAAAIAQLKARGTSVVLVTHRSSVLALADKLLVLNE
GRLQAFGPSQEVLKALAGGQQAQAQEAPKPVAAAPGGLSMSRQYQAPTRNSGA
Download sequence
Identical sequences A0A1K1U1K4 A0A2C9ENA0 A0A2K4LZ83 Q4KBS0
gi|70730572|ref|YP_260313.1| gi|501680686|ref|YP_008000512.1| WP_011061492.1.100210 WP_011061492.1.101844 WP_011061492.1.12653 WP_011061492.1.14038 WP_011061492.1.18072 WP_011061492.1.23266 WP_011061492.1.27351 WP_011061492.1.38500 WP_011061492.1.39301 WP_011061492.1.42452 WP_011061492.1.42693 WP_011061492.1.46426 WP_011061492.1.49818 WP_011061492.1.58641 WP_011061492.1.62026 WP_011061492.1.64508 WP_011061492.1.76749 WP_011061492.1.76969 WP_011061492.1.81001 WP_011061492.1.81277 WP_011061492.1.83211 WP_011061492.1.88821 220664.PFL_3208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]