SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501680757|ref|YP_008000583.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501680757|ref|YP_008000583.1|
Domain Number 1 Region: 65-340
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.88e-52
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501680757|ref|YP_008000583.1|
Sequence length 349
Comment BNR/Asp-box repeat protein [Pseudomonas protegens CHA0]
Sequence
MSEPVMGVVVGRPPALRTFALLATALSLLGVVTLSTPVLAAATAADSVYSIESPKAAKSL
MLDVVHAGKRLVAVGDRGHILYSDDQGQTWVQAKVPTRQLLTAVYFVDDKRGWAVGHDAQ
VLASSDGGATWTRQFQDLKREAPLLDVWFKDTQTGYAVGAYGALLETSDGGQHWEDVSDR
LDNEDQFHLNAIAQVKDSGLFIVGEQGSMFRSADDGQTWERLEGPYEGSLFGVIGTGQPA
TLLVYGLRGNLYRSTDFGSTWEQVELNAARGALEFGLSGATLLDDGSLVIVGNGGSVIRS
TDHGQTFSVFNRADRISLSAVTAAGNGDLILAGQGGVRVSAATGAELGQ
Download sequence
Identical sequences A0A1K1TZ06 A0A2C9ENA8 A0A2K2WLH2 Q4KBJ9
gi|70730643|ref|YP_260384.1| 220664.PFL_3279 PlR310 WP_011061562.1.101844 WP_011061562.1.11424 WP_011061562.1.14038 WP_011061562.1.1721 WP_011061562.1.18072 WP_011061562.1.21308 WP_011061562.1.23266 WP_011061562.1.27351 WP_011061562.1.38500 WP_011061562.1.41899 WP_011061562.1.42693 WP_011061562.1.462 WP_011061562.1.49818 WP_011061562.1.58641 WP_011061562.1.62026 WP_011061562.1.6225 WP_011061562.1.67749 WP_011061562.1.76749 WP_011061562.1.88821 gi|501680757|ref|YP_008000583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]