SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501681448|ref|YP_008001274.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501681448|ref|YP_008001274.1|
Domain Number 1 Region: 5-178
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.35e-32
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501681448|ref|YP_008001274.1|
Sequence length 179
Comment cytochrome b561 family protein [Pseudomonas protegens CHA0]
Sequence
MNSQPRHFAPLARLLHWLMALLIIAMLFIGAGMVASVSARHEWLIHLHKPLGIAILLLVL
VRLWVRFYTRQPPLPADLPGWQVLAAKASHVLLYALMLSLPLLGWGMISAAGDPVMLGSS
LQLPAILPANAQLFAVLRKAHGYLAYLLFFTVLLHLAAALFHGWVRRDGVLQSMLRGRG
Download sequence
Identical sequences A0A1K2C874 A0A2C9EQ22 Q4K9N8
220664.PFL_3945 gi|501681448|ref|YP_008001274.1| GO.8008 WP_011062232.1.101844 WP_011062232.1.14038 WP_011062232.1.18072 WP_011062232.1.23266 WP_011062232.1.27351 WP_011062232.1.38500 WP_011062232.1.39301 WP_011062232.1.42452 WP_011062232.1.42693 WP_011062232.1.46426 WP_011062232.1.49818 WP_011062232.1.58641 WP_011062232.1.62026 WP_011062232.1.64508 WP_011062232.1.76749 WP_011062232.1.81001 WP_011062232.1.81277 WP_011062232.1.83211 gi|70731304|ref|YP_261045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]