SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501681470|ref|YP_008001296.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501681470|ref|YP_008001296.1|
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.89e-32
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501681470|ref|YP_008001296.1|
Sequence length 184
Comment cytochrome b561 [Pseudomonas protegens CHA0]
Sequence
MPWKNTESRYSTMTIALHWLMLVLLAVVYACIEFRGIFPKGSGGRTLIVEAHFMLGLTVF
ALVWLRLFARAQGVAPKILPTPPHWQRLLLTLMHWALYLFMIAMPILGWLTTSAKGHQVM
FYGLDLPLLLAENKPLAKQLQGWHELLGTVGYWLIGLHALAGLYHHYVMRDNTLQRMWRK
RGQA
Download sequence
Identical sequences A0A2C9EQ45
WP_015636338.1.27351 WP_015636338.1.76749 gi|501681470|ref|YP_008001296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]