SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501681492|ref|YP_008001318.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501681492|ref|YP_008001318.1|
Domain Number 1 Region: 123-281
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.08e-52
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000105
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 3.17e-40
Family Tetrahydrofolate dehydrogenase/cyclohydrolase 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501681492|ref|YP_008001318.1|
Sequence length 284
Comment bifunctional protein FolD [Pseudomonas protegens CHA0]
Sequence
MTAQLIDGKAIAASLRQQIAKRVAERRQQGLRTPGLAVILVGSDPASQVYVSHKRKDCEE
VGFLSQAYDLPANTTQEDLAGLIDRLNDDPNIDGVLLQLPLPEHLDASLLLERIRPDKDV
DGFHPYNVGRLAQRIPLLRPCTPKGIMTLLESTGADLYGMDAVVVGASNIVGRPMAMELL
LAGCTVTVTHRFTKDLAGHVGRADLVVVAAGKPGLVKGEWIKEGAIVIDVGINRQDDGKL
VGDVVYETALPRAGWITPVPGGVGPMTRACLLENTLYAAESLHS
Download sequence
Identical sequences A0A2C9EQ73 A0A2K2WNE6 Q4K9J4
gi|501681492|ref|YP_008001318.1| 220664.PFL_3992 WP_011062276.1.100210 WP_011062276.1.11424 WP_011062276.1.12653 WP_011062276.1.14038 WP_011062276.1.1721 WP_011062276.1.18072 WP_011062276.1.21308 WP_011062276.1.27351 WP_011062276.1.39301 WP_011062276.1.41899 WP_011062276.1.42452 WP_011062276.1.42693 WP_011062276.1.462 WP_011062276.1.46426 WP_011062276.1.48506 WP_011062276.1.49818 WP_011062276.1.6225 WP_011062276.1.64508 WP_011062276.1.6649 WP_011062276.1.67749 WP_011062276.1.76749 WP_011062276.1.79484 WP_011062276.1.81001 WP_011062276.1.81277 WP_011062276.1.83211 WP_011062276.1.88821 gi|70731348|ref|YP_261089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]