SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501681505|ref|YP_008001331.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501681505|ref|YP_008001331.1|
Domain Number 1 Region: 106-267
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.22e-30
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000497
Further Details:      
 
Domain Number 2 Region: 9-105
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 5.76e-26
Family Shikimate dehydrogenase-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501681505|ref|YP_008001331.1|
Sequence length 272
Comment shikimate 5-dehydrogenase-like protein HI [Pseudomonas protegens CHA0]
Sequence
MQMNPNKDTQLCMSLSGRPGNFGLRFHNHLYEQLGLNFYYKAFSSQDLSGAVAGIRALGI
RGCGVSMPFKEDCIALVDELDASARAIASINTIVNTNGHLKAYNTDYIAVAQLLAGHGVP
RESSFALRGSGGMAKAVASALRDGGYANGVIVARNEVAGRALASSLGYEWQAELGSLRPQ
MLINVTPIGMSGGPEAQQLAFDAEAITAAQTVFDVVAVPPETPLILRARAEGKQVITGLE
VIAIQALEQFVLYTGVRPSEEQFQRAVAFARP
Download sequence
Identical sequences A0A2C9EQ90
WP_015636358.1.27351 WP_015636358.1.76749 gi|501681505|ref|YP_008001331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]