SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501681637|ref|YP_008001463.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501681637|ref|YP_008001463.1|
Domain Number 1 Region: 340-564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.54e-70
Family ABC transporter ATPase domain-like 0.00000594
Further Details:      
 
Domain Number 2 Region: 23-342
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 8.5e-70
Family ABC transporter transmembrane region 0.0000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501681637|ref|YP_008001463.1|
Sequence length 572
Comment putative multidrug export ATP-binding/permease protein [Pseudomonas protegens CHA0]
Sequence
MRRLITRLVDSRDPQALSAALGWLYSFVRPHRLAIGGLLGLSVCASLLVLVQPWLTKLLI
DDGLLARDFPRLVLIAALMIGAGLLGTVLSGVNRYLHTRLSGRILFALRDDLYRHLQRLS
PSFYGQRRIGDLMSRLDGDVAEIQRFAVDSLFSAVSSVIGLVVALAMLLTLSWQLSLLAL
VLIPLDVLWLRWMRRKVERDVRQLRERSADMSSFMVETLPVMKFIQSAGQQQREAQRLDG
LGQGYMSQLLKLQVTEFFTQAVPGTLTSLSRACAFLIGGYWVVQGTWQLGALIAFSTYLG
MAVGPVQSLLGLYVAIQRMTVSLGRVMELRGEEPGISNPEAPLPVPEQGELHFHAVHFCH
PGRASTLQGIEARIPYGRKVALSGTSGAGKSTLIDLLQRHHDPQSGQVLLGGVDLRQLDL
AQLRRRVAVVSQDIVLFRGSLADNLAYSVPDASREAVAEVARLAQLQGLIESLPEGLDSP
LGERGQQLSGGQKQRIAIARALLQDPMILVLDEATSAVDEATEREVIEAIDRLFAGRTRI
LISHRPSTLADAELRFELRDGVLHALEVAHEA
Download sequence
Identical sequences A0A2C9EQS1
gi|501681637|ref|YP_008001463.1| WP_015636455.1.27351 WP_015636455.1.76749 WP_015636455.1.88821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]