SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501681749|ref|YP_008001575.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|501681749|ref|YP_008001575.1|
Domain Number - Region: 159-223
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0863
Family ABC transporter transmembrane region 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501681749|ref|YP_008001575.1|
Sequence length 295
Comment protease HtpX [Pseudomonas protegens CHA0]
Sequence
MMRILLFLATNLAVVLIASITLSLFGFNGFMAANGVDLNLNQLLIFCAVFGFAGSLFSLF
ISKWMAKMSTSTQIITQPRTRHEQWLLQTVEQLSREAGIKMPEVGIFPAYEANAFATGWN
KNDALVAVSQGLLERFSPDEVKAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIIGN
FVDKVIFKNEEGQGIAYYVATIFAELVLGILASAIVMWFSRKREYRADEAGARLAGTNAM
IGALQRLRSEQGLPVHMPDTLNAFGINGGIKQGLARMFMSHPPLEERIEALRRRG
Download sequence
Identical sequences A0A1K1VEP1 A0A2C9ER43 A0A2K4M4X7
WP_015636531.1.100210 WP_015636531.1.101844 WP_015636531.1.11424 WP_015636531.1.12653 WP_015636531.1.1721 WP_015636531.1.21308 WP_015636531.1.23266 WP_015636531.1.27351 WP_015636531.1.38500 WP_015636531.1.39301 WP_015636531.1.41899 WP_015636531.1.42452 WP_015636531.1.462 WP_015636531.1.46426 WP_015636531.1.48506 WP_015636531.1.49818 WP_015636531.1.58641 WP_015636531.1.62026 WP_015636531.1.6225 WP_015636531.1.64508 WP_015636531.1.6649 WP_015636531.1.67749 WP_015636531.1.76749 WP_015636531.1.76969 WP_015636531.1.79484 WP_015636531.1.81001 WP_015636531.1.81277 WP_015636531.1.83211 WP_015636531.1.88821 gi|501681749|ref|YP_008001575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]