SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501681862|ref|YP_008001688.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|501681862|ref|YP_008001688.1|
Domain Number - Region: 10-103
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.00379
Family ABC transporter transmembrane region 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501681862|ref|YP_008001688.1|
Sequence length 106
Comment hypothetical protein PFLCHA0_c44250 [Pseudomonas protegens CHA0]
Sequence
MKISDGFDARRLRPKSPRNWRLRLGAGFSALLATFGVLLAMAGTASLLGRAPALGEMNAS
PAGSAVILVVGLLLLYVGVRLWRRCRRRMRQPLALNMAPHLMKKHD
Download sequence
Identical sequences A0A1K1VMT5 A0A2C9ER85 A0A2K2X1I0 Q4K8I8
220664.PFL_4353 WP_011062623.1.100210 WP_011062623.1.101844 WP_011062623.1.11424 WP_011062623.1.12653 WP_011062623.1.14038 WP_011062623.1.1721 WP_011062623.1.18072 WP_011062623.1.21308 WP_011062623.1.23266 WP_011062623.1.27351 WP_011062623.1.38500 WP_011062623.1.39301 WP_011062623.1.41899 WP_011062623.1.42452 WP_011062623.1.42693 WP_011062623.1.462 WP_011062623.1.46426 WP_011062623.1.49818 WP_011062623.1.58641 WP_011062623.1.62026 WP_011062623.1.6225 WP_011062623.1.64508 WP_011062623.1.67749 WP_011062623.1.76749 WP_011062623.1.76969 WP_011062623.1.81001 WP_011062623.1.81277 WP_011062623.1.83211 WP_011062623.1.88821 gi|70731703|ref|YP_261445.1| gi|501681862|ref|YP_008001688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]