SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501682147|ref|YP_008001973.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501682147|ref|YP_008001973.1|
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily Folate-binding domain 5.65e-90
Family Aminomethyltransferase folate-binding domain 0.00000333
Further Details:      
 
Domain Number 2 Region: 279-373
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 7.19e-26
Family Aminomethyltransferase beta-barrel domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501682147|ref|YP_008001973.1|
Sequence length 374
Comment aminomethyltransferase GcvT [Pseudomonas protegens CHA0]
Sequence
MSTETLLKTPLHSLHLELGARMVPFAGYDMPVQYPLGVMKEHQHTREQAGLFDVSHMGQI
LLRGANAAQALETLVPVDIIDLPVGMQRYAMFTNEQGGILDDLMVANLGDEQLFLVVNAA
CKDQDLAHLRRHLGEQCDIQPLFEERALLALQGPAAVTVLARLAPEVAQMTFMQFKPVTL
LGVDCFVSRSGYTGEDGFEISVPAAQAEKLARALLAEPEVAAIGLGARDSLRLEAGLCLY
GHDMNSDTTPIQASLLWAISKARRADGARAGSFPGAEVIFAQQQGGVSRKRVGLLPQERT
PVREGAEIVDAEGKVIGSVCSGGFGPTLGGPLAMGYLDIEHCALDTPVAAIVRGKKVPML
VSKMPFVPQRYYRG
Download sequence
Identical sequences A0A2C9ES96
WP_015636753.1.27351 WP_015636753.1.76749 gi|501682147|ref|YP_008001973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]