SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501682202|ref|YP_008002028.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501682202|ref|YP_008002028.1|
Domain Number 1 Region: 241-366
Classification Level Classification E-value
Superfamily vWA-like 0.000000237
Family Ku70 subunit N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501682202|ref|YP_008002028.1|
Sequence length 443
Comment hypothetical protein PFLCHA0_c47740 [Pseudomonas protegens CHA0]
Sequence
MKPTRLLLIWLGTLTGLYTLLGAARALGSEALPRLDSIAWGLLLALLLLALLDALRLLRV
ASPQIQRQLPGSLPLGRWSEVQLEILHDYRQPLDVQLFDHPPQGLGFEHLPQSTRLEPGQ
VSRIGYNVRPLQRGHFNFDQCEVSLPSPLGLWSARRLLKVHDSTRVYPDFARLYGAQLLA
VDNWLSQLGVRQRQRRGLGLEFNQLREFREGDSLRQIDWKATARQRAPIVREYQDERDQQ
IIFMLDCGRRMRSQDGELAHFDHALNACLLLSYVALRQGDAVGLYSFAGERSRYLAPVKG
SAQLSVLLNGVYDLDTSQRPADYQAAASELLARQKRRALVVLITNLRDEDDQELLTAVKR
IGRQHRVLVASLREEVLDQLRQSPVQTLPEALAYSATVNYLNSRAELHERLSAHGVALLD
ARPGELGAELVSRYLSWKKAGSL
Download sequence
Identical sequences A0A2C9ES68 Q4K7A8
gi|501682202|ref|YP_008002028.1| 220664.PFL_4794 WP_011063048.1.100210 WP_011063048.1.14038 WP_011063048.1.18072 WP_011063048.1.27351 WP_011063048.1.39301 WP_011063048.1.42693 WP_011063048.1.46426 WP_011063048.1.48506 WP_011063048.1.49818 WP_011063048.1.64508 WP_011063048.1.76749 WP_011063048.1.81001 WP_011063048.1.81277 WP_011063048.1.83211 WP_011063048.1.88821 gi|70732119|ref|YP_261875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]