SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501682434|ref|YP_008002260.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501682434|ref|YP_008002260.1|
Domain Number 1 Region: 10-178
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.67e-25
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501682434|ref|YP_008002260.1|
Sequence length 184
Comment cytochrome b561 family protein [Pseudomonas protegens CHA0]
Sequence
MENRIELYDSKVRYGVISRGLHWAMALAFAWIYSTTSAHYLMADSALDKFLWPTHKQVGL
LLMALLLVRVVWSLLNRHRRPPSLNLAATLGHGLLYAGMFAIPFLGLLRQYGSGRAFSAF
GLPVMNGFDGPKIQWMTELGNNFHSLLGWTLLVLIVGHVAALILHCIKGQGHILRRMAGS
ARSA
Download sequence
Identical sequences A0A2C9ESW6
WP_015636915.1.27351 WP_015636915.1.76749 gi|501682434|ref|YP_008002260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]