SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501682481|ref|YP_008002307.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501682481|ref|YP_008002307.1|
Domain Number 1 Region: 6-278
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 7.38e-96
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000376
Further Details:      
 
Domain Number 2 Region: 280-396
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.24e-33
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501682481|ref|YP_008002307.1|
Sequence length 403
Comment cytochrome b [Pseudomonas protegens CHA0]
Sequence
MSKFMDWVDARFPATKMWEDHLSKYYAPKNFNFFYFFGSLALLVLVNQIVTGVWLTMSYT
PSAEEAFASVEYIMRDVEYGAILRLLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVWL
FGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGDDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKNKDENGIPLDGIPFHPYY
TVKDIVGVVVFLFIFCSIVFFFPEMGGYFLEKPNFEQANPFKTPEHIAPVWYFTPFYAIL
RAVPDKLMGVIAMGAAIAVLFVLPWLDRSPVKSMRYKGWLSKIWLLVFCISFVILGVLGV
LAPTPGRTLLSQVCTFLYFAYFILMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A1K1WP35 A0A2C9ET12 A0A2K4M1C8 Q4K6H5
gi|70732402|ref|YP_262158.1| WP_011063328.1.100210 WP_011063328.1.101844 WP_011063328.1.11424 WP_011063328.1.12653 WP_011063328.1.14038 WP_011063328.1.1721 WP_011063328.1.18072 WP_011063328.1.21308 WP_011063328.1.23266 WP_011063328.1.27351 WP_011063328.1.38500 WP_011063328.1.39301 WP_011063328.1.41899 WP_011063328.1.42452 WP_011063328.1.42693 WP_011063328.1.462 WP_011063328.1.46426 WP_011063328.1.48506 WP_011063328.1.49818 WP_011063328.1.58641 WP_011063328.1.62026 WP_011063328.1.6225 WP_011063328.1.64508 WP_011063328.1.67749 WP_011063328.1.76749 WP_011063328.1.81001 WP_011063328.1.81277 WP_011063328.1.83211 WP_011063328.1.88821 gi|501682481|ref|YP_008002307.1| 220664.PFL_5079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]