SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501682732|ref|YP_008002558.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501682732|ref|YP_008002558.1|
Domain Number 1 Region: 200-444
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.17e-78
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000144
Further Details:      
 
Domain Number 2 Region: 5-194
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 8e-74
Family Aminoacid dehydrogenases 0.000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501682732|ref|YP_008002558.1|
Sequence length 445
Comment NADP-specific glutamate dehydrogenase GdhA [Pseudomonas protegens CHA0]
Sequence
MIESVEDFLARLKKRDPDQPEFHQAVEEVLRSLWPFLEANPHYLSSGILERICEPERAVV
FRVSWVDDQGKVRVNRGFRIQMNSAIGPYKGGLRFHPSVNMGVLKFLAFEQTFKNSLTSL
PMGGGKGGSDFNPKGKSDAEVMRFCQAFMSELYRHIGADVDVPAGDIGVGAREIGFLFGQ
YKRLSNQFTSVLTGKGISYGGSLIRPEATGFGCVYFAEEMLKRRGDRVEGKRVAISGSGN
VAQYAARKVMDLGGKVISLSDSEGTLYCESGLSEEQWLAVLELKNVQRGRISELASQFGL
EFRAGKTPWDLPCDIALPCATQNELDAEAARTLLRNDCTCVAEGANMPTTLEAVDIFIDA
GILFAPGKASNAGGVAVSGLEMSQNAMRLLWTAGEVDSKLHNIMQSIHHACVHYGEENGR
INYVKGANIAGFVKVADAMLAQGVV
Download sequence
Identical sequences A0A2C9ETQ4
gi|501682732|ref|YP_008002558.1| WP_015637102.1.27351 WP_015637102.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]