SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501682764|ref|YP_008002590.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501682764|ref|YP_008002590.1|
Domain Number 1 Region: 323-558
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-64
Family ABC transporter ATPase domain-like 0.0000288
Further Details:      
 
Domain Number 2 Region: 16-320
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 5.49e-43
Family ABC transporter transmembrane region 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501682764|ref|YP_008002590.1|
Sequence length 594
Comment alkaline protease secretion ATP-binding protein AprD [Pseudomonas protegens CHA0]
Sequence
MSRPNPLAASETLAALTAYKGGFFNIGLFSAVINLLMLAPALYMLQVYDRVLASGNQMTL
LMLTLMILGLFGLMGALEWVRSQVVIHLGTQMDMRLNQRVYDAAFEAQLKGSPQAAGQAL
NDLTALRQFATGNALFAFFDAPWFPVYLLVIFLFHPWLGLLALAGAVLLVALAWINQHIC
QAPLAQASQLSIITSQQATANLRNADAIEAMGMLGALRERWFIGHQGFLAQQNLASEKTA
TISAWSKGVRMALQSLVLGLGAWLAVQGQITPGMMIAGSILMGRVLSPIDQLIAVWKQWS
SARLAYERLSQLLQANPPRPARMSLPTPKGKLSVEQLSACAPGSRRPALSNLGFTLEAGQ
VLGVIGPSGCGKSTLARLLVGAWMPLTGKVRLDGADLAQWDRQQLGPHIGYLPQDIQLFA
GSIAENIARFAQLDSDQVLQAAQMAGVHELILQLPQGYDTRLGEGGAGLSGGQRQRIGLA
RALYGLPALIVLDEPNSNLDEAGEQALLQAISQLKQRQRTLVLITHKPNVLTLTDQLMIL
REGQLQAFGPTARVLEANQKAKAAPPPAVPVSNPVTSLNMNYRLGVAGGEGKKA
Download sequence
Identical sequences A0A2C9ETT5
gi|501682764|ref|YP_008002590.1| WP_015637122.1.27351 WP_015637122.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]