SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501682770|ref|YP_008002596.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501682770|ref|YP_008002596.1|
Domain Number 1 Region: 111-281
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.8e-37
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 2.01e-25
Family Shikimate dehydrogenase-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501682770|ref|YP_008002596.1|
Sequence length 284
Comment shikimate dehydrogenase AroE [Pseudomonas protegens CHA0]
Sequence
MSRQASVLAGLIGAGIQASRTPALHEQEGDAQHLRYLYRLIDLDQLGLDSSALPELLRAA
EQMSFTGLNITFPCKQSILPLLDELSPEAQGIGAVNTVVLKDGKRVGHNTDCLGFAEGFR
RGLQDVARRQVVQMGAGGAGAAVAHALLSEGVEQLNIFDVEPQRAQSLADNLNQHFGSAR
ARAGGDLSSALHSADGLVNTTPMGMAKLPGMPVPVELLRAQLWVAEIVYFPLETELLRNA
RALGCRTLDGGTMAVFQAVKAFELFSGQRADPQRMLAHFHSMNG
Download sequence
Identical sequences A0A2C9ETU3
gi|501682770|ref|YP_008002596.1| WP_015637126.1.27351 WP_015637126.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]