SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501682941|ref|YP_008002767.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501682941|ref|YP_008002767.1|
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Ribosomal protein L14 2.75e-52
Family Ribosomal protein L14 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501682941|ref|YP_008002767.1|
Sequence length 122
Comment 50S ribosomal protein L14 [Pseudomonas protegens CHA0]
Sequence
MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTA
VVVRTRHGVRRADGSIIRFDGNAAVLLNNKQEPIGTRIFGPVTRELRNEKFMKIVSLAPE
VL
Download sequence
Identical sequences A0A0A7JPC6 A0A0J6HLQ3 A0A160GKP8 A0A1K2CF10 A0A2C9EUA8 A0A2K4LIQ8 Q4K543
gi|70732872|ref|YP_262640.1| 220664.PFL_5572 gi|501682941|ref|YP_008002767.1| WP_011063774.1.100210 WP_011063774.1.101844 WP_011063774.1.10315 WP_011063774.1.11424 WP_011063774.1.12653 WP_011063774.1.13620 WP_011063774.1.14038 WP_011063774.1.14704 WP_011063774.1.1721 WP_011063774.1.18072 WP_011063774.1.20076 WP_011063774.1.21308 WP_011063774.1.23266 WP_011063774.1.27351 WP_011063774.1.35379 WP_011063774.1.38500 WP_011063774.1.39301 WP_011063774.1.41899 WP_011063774.1.42452 WP_011063774.1.42693 WP_011063774.1.45814 WP_011063774.1.462 WP_011063774.1.46426 WP_011063774.1.48506 WP_011063774.1.49818 WP_011063774.1.58641 WP_011063774.1.59644 WP_011063774.1.62026 WP_011063774.1.6225 WP_011063774.1.64508 WP_011063774.1.66304 WP_011063774.1.6649 WP_011063774.1.67749 WP_011063774.1.73339 WP_011063774.1.7340 WP_011063774.1.76749 WP_011063774.1.76969 WP_011063774.1.79484 WP_011063774.1.81001 WP_011063774.1.81277 WP_011063774.1.83211 WP_011063774.1.88821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]