SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501683085|ref|YP_008002911.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501683085|ref|YP_008002911.1|
Domain Number 1 Region: 614-896
Classification Level Classification E-value
Superfamily Folate-binding domain 1.88e-92
Family Aminomethyltransferase folate-binding domain 0.0000317
Further Details:      
 
Domain Number 2 Region: 167-472
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.056
Further Details:      
 
Domain Number 3 Region: 907-1003
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000000491
Family Aminomethyltransferase beta-barrel domain 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|501683085|ref|YP_008002911.1|
Domain Number - Region: 19-57
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0678
Family 2Fe-2S ferredoxin-related 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501683085|ref|YP_008002911.1|
Sequence length 1005
Comment sarcosine oxidase subunit alpha [Pseudomonas protegens CHA0]
Sequence
MSQTNRLSNGGRIDRNKVLTFTFNGQSYKGFEGDTLASALLANGVDIIGRSFKYSRPRGI
FAAGCEEPNAVLQIGATEATQIPNVRATQQALYQGLVATSTNGWPSVNNDMMGILGKVGG
KLMPPGFYYKTFMYPQSFWMTYEKYIRKAAGLGRSPTENDPDTYDNMNQHCDVLIVGAGP
AGLAAALAAARSGARVILADEQEEFGGTLLDSRESLDGKPAAEWVASVVAELQSLPDVLL
LPRATVNGYHDHNFLTIHERLTDHLGDRAPIGQVRQRIHRVRAKRVVLATGAHERPLVYG
NNDVPGNMLAGAVSTYVRRYGVAPGKKLVLSTNNDHAYRVALDWLDASLQVVAIADARHN
PRGALVEEARAKGIRILTSSAVIEARGSKHVTGARVAAIDVKAHKVTSPGEWLDCDLIAS
SGGYSPVVHLASHLGGKPVWREDILGFVPGEAPQKRVCVGGINGVYSLGDTLADGFEGGV
RAASEAGFQAVEGVLPKALARLEEPTLALFQVPHEKGTARAPKQFVDLQNDVTAAAIELA
TREGFESVEHVKRYTALGFGTDQGKLGNVNGLAIAARSLNVSIPQMGTTMFRPNYTPITF
GAVAGRHCGHIFEPVRFTALHAWHVKNGAEFEDVGQWKRPWYFPKNGEDLHAAVKRECQA
VRDSVGLLDASTLGKIDIQGPDAREFLNRIYTNAWTKLDVGKARYGLMCKEDGMVFDDGV
TACLADNHFLMTTTTGGAARVLQWLEIYQQTEWPDLKVYFTSVTDHWATMTLSGPNSRKL
LSEVTDIDLDKDGFPFMTWKEGLVGGVPARVFRISFTGELSYEVNVQADYAMGVLEQIVE
AGKKYNLTPYGTETMHVLRAEKGFIIVGQDTDGSMTPDDLNMGWCVGRTKPFSWIGWRGM
NREDCVREQRKQLVGLKPIDPTQWLPEGAQLVFNPKQAIPMSMVGHVTSSYAHNSLGYSF
ALGVVKGGLKRLGERVFAPLADGRVIEAEIVSSVFFDPKGDRQNI
Download sequence
Identical sequences A0A1K1ZWK1 A0A2C9EUP9 A0A2K4LFD5
gi|501683085|ref|YP_008002911.1| WP_015637299.1.100210 WP_015637299.1.101844 WP_015637299.1.11424 WP_015637299.1.12653 WP_015637299.1.1721 WP_015637299.1.21308 WP_015637299.1.23266 WP_015637299.1.27351 WP_015637299.1.38500 WP_015637299.1.39301 WP_015637299.1.41899 WP_015637299.1.42452 WP_015637299.1.462 WP_015637299.1.46426 WP_015637299.1.49818 WP_015637299.1.58641 WP_015637299.1.62026 WP_015637299.1.6225 WP_015637299.1.64508 WP_015637299.1.67749 WP_015637299.1.76749 WP_015637299.1.76969 WP_015637299.1.81001 WP_015637299.1.81277 WP_015637299.1.83211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]