SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501683323|ref|YP_008003149.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501683323|ref|YP_008003149.1|
Domain Number 1 Region: 3-277
Classification Level Classification E-value
Superfamily Folate-binding domain 3.14e-88
Family Aminomethyltransferase folate-binding domain 0.0000000614
Further Details:      
 
Domain Number 2 Region: 270-357
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 3.11e-24
Family Aminomethyltransferase beta-barrel domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501683323|ref|YP_008003149.1|
Sequence length 360
Comment aminomethyltransferase GcvT [Pseudomonas protegens CHA0]
Sequence
MGQRTPLYDLHLALGAKMVDFGGWDMPLHYGSQVEEHHQVRRDCGVFDVSHMTVIDVSGT
QAKAWLQRLLANDVERLHNPGQALYSTMLNERGGIVDDMIVYRLEDAYRLALNAATRDQD
LAWMQAQLGDFQVQLHERPELAMLAIQGPQARHKIAELVTQSRGTLIQQLKPFEAGFDGD
WFIARTGYTGEDGLEIVLPADQAPAFFNDLVGAGISPIGLGARDTLRLEAGMNLYGQDIH
QDVSPLAANMAWSIAWEPASRQFIGRSALEAERAAGVKQKLVGLVLEERGVLRAHQVVRI
ADVGEGEITSGSFSPTLSKSIALARVPMATADRAEVEIRGKWYPVRVVKPTFVRHGKTLI
Download sequence
Identical sequences A0A1K2A6J0 A0A2C9EVF4 Q4K413
220664.PFL_5962 gi|501683323|ref|YP_008003149.1| WP_011064136.1.100210 WP_011064136.1.101844 WP_011064136.1.11424 WP_011064136.1.12653 WP_011064136.1.14038 WP_011064136.1.1721 WP_011064136.1.18072 WP_011064136.1.21308 WP_011064136.1.23266 WP_011064136.1.27351 WP_011064136.1.38500 WP_011064136.1.41899 WP_011064136.1.42693 WP_011064136.1.462 WP_011064136.1.49818 WP_011064136.1.58641 WP_011064136.1.62026 WP_011064136.1.6225 WP_011064136.1.6649 WP_011064136.1.67749 WP_011064136.1.76749 WP_011064136.1.79484 WP_011064136.1.88821 gi|70733247|ref|YP_263020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]