SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501683332|ref|YP_008003158.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501683332|ref|YP_008003158.1|
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 7.45e-22
Family Cell division protein ZapA-like 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501683332|ref|YP_008003158.1|
Sequence length 107
Comment cell division protein ZapA [Pseudomonas protegens CHA0]
Sequence
MSSSNSVTVQILDKEYSIICPQEERSNLVSAARYLDGKMREIRSSGKVIGADRIAVMAAL
NITHDLLHRQERPDVQASATTREQVRDLLERVDLVLATDSDTSKADS
Download sequence
Identical sequences A0A1K2A6H6 A0A2C9EVG1 A0A2K4LYK4 Q4K405
gi|70733255|ref|YP_263028.1| gi|501683332|ref|YP_008003158.1| WP_011064145.1.100210 WP_011064145.1.101844 WP_011064145.1.11424 WP_011064145.1.12653 WP_011064145.1.14038 WP_011064145.1.1721 WP_011064145.1.18072 WP_011064145.1.21308 WP_011064145.1.23266 WP_011064145.1.27351 WP_011064145.1.38500 WP_011064145.1.39301 WP_011064145.1.41899 WP_011064145.1.42452 WP_011064145.1.42693 WP_011064145.1.462 WP_011064145.1.46426 WP_011064145.1.48506 WP_011064145.1.49818 WP_011064145.1.58641 WP_011064145.1.62026 WP_011064145.1.6225 WP_011064145.1.64508 WP_011064145.1.6649 WP_011064145.1.67749 WP_011064145.1.76749 WP_011064145.1.76969 WP_011064145.1.79484 WP_011064145.1.81001 WP_011064145.1.81277 WP_011064145.1.88821 220664.PFL_5970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]