SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501683378|ref|YP_008003204.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501683378|ref|YP_008003204.1|
Domain Number 1 Region: 26-282
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.14e-81
Family Alanine racemase-like, N-terminal domain 0.0000046
Further Details:      
 
Domain Number 2 Region: 254-411
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.84e-54
Family Eukaryotic ODC-like 0.0000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501683378|ref|YP_008003204.1|
Sequence length 415
Comment diaminopimelate decarboxylase LysA [Pseudomonas protegens CHA0]
Sequence
MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYQAYAQALSGMPHLVCFAVK
ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGQADKIVFSGVGKTRDDMRRALEVGVH
CFNVESAEELERLQLVAAELGVRAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIATAED
VYIRAAQLPNLEIVGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGECGIYLRHIDLGGGL
GVRYRDEEPPLAADYVKAVRERLDGRDLALVFEPGRFIVANAGVLLTRVEYLKHTEHKDF
AIVDGAMNDLIRPALYQAWMDVSAVRPRDTEPRTYDIVGPICETGDFLAKERTLALAEGD
LLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGDQAVEVRRRETVAELFAGESLLPE
Download sequence
Identical sequences A0A2C9EVL8
gi|501683378|ref|YP_008003204.1| WP_015637453.1.27351 WP_015637453.1.42452 WP_015637453.1.76749 WP_015637453.1.88821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]