SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501683402|ref|YP_008003228.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501683402|ref|YP_008003228.1|
Domain Number 1 Region: 8-233
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.83e-73
Family Alanine racemase-like, N-terminal domain 0.00000000986
Further Details:      
 
Domain Number 2 Region: 228-349
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.63e-45
Family Alanine racemase 0.00000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501683402|ref|YP_008003228.1|
Sequence length 357
Comment alanine racemase Alr [Pseudomonas protegens CHA0]
Sequence
MRPARALIDLQALRHNYQLARETSGVRALAVIKADAYGHGAVRCAQALEGEADGFAVACI
EEALELRAAGIRAPVLLLEGFFEASELALIVEHDFWCVVHSLWQLEAIEQAAVAKPLTVW
LKLDSGMHRVGLHPKDYQAAYQRLQASGKVEKIVLMSHFARADELDCPRSSEQVAVFEAA
RQGLGAEISLRNSPAVMGWPSVPSDWVRPGIMLYGSTPFEENNSVAARLQPVMTLESKVI
CVRELPAGEPVGYGARFITDRPMRIGVVAMGYADGYPRHAPTGTPVLVAGQRSRLLGRVS
MDMLCVDLTDVPQAGLGSTVELWGKNILASDVAQAADTIPYQLFCNLRRVPLVYCEG
Download sequence
Identical sequences A0A2C9EVN4
WP_015637463.1.27351 WP_015637463.1.39301 WP_015637463.1.42452 WP_015637463.1.46426 WP_015637463.1.64508 WP_015637463.1.76749 WP_015637463.1.81001 WP_015637463.1.81277 gi|501683402|ref|YP_008003228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]