SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501678302|ref|YP_007998128.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501678302|ref|YP_007998128.1|
Domain Number 1 Region: 71-95,141-301
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.51e-43
Family YkgG-like 0.0078
Further Details:      
 
Domain Number 2 Region: 290-397
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.26e-16
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501678302|ref|YP_007998128.1|
Sequence length 484
Comment lactate utilization protein B [Pseudomonas protegens CHA0]
Sequence
MSTPELIPTTTLADDFRTRAHQALGDQQLRNNFRSAMDSLMAKRAASFSDAHEREHLRAL
GNAIRARALSKLPDLLERLEQNLTRNGVTVHWAETVDEANGIVLSIIRAHEARQVIKGKS
MVSEEMEMNHVLAEQGIECLESDMGEFIVQLDHEKPSHIIMPAIHKNAGQVASLFHDKLG
VEYTKDVDQLIQIGRKVLRQKFFEADIGVSGVNFAVAETGTLLLVENEGNGRMSTTVPPV
HIAVTGIEKVVENLRDVVPLLSLLTRSALGQPITTYVNMISGPRKEHELDGPQEVHLVLL
DNGRSQAFADSELRQTLNCIRCGACMNHCPVYTRVGGHTYGEVYPGPIGKIITPHMVGLA
KVPDHPSASSLCGACGEVCPVKIPIPALLRRLREENVKAPDSPHQVMRGQGSKYSRKERF
IWNAWARLNSSPRLYRLFTLAATRLRALTPSKVGPWTQNHSAPKPAARSLHDLAREHLDT
QGDR
Download sequence
Identical sequences A0A2C9EG55
gi|501678302|ref|YP_007998128.1| WP_015634105.1.27351 WP_015634105.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]