SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501683266|ref|YP_008003092.1| from Pseudomonas protegens CHA0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501683266|ref|YP_008003092.1|
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.61e-42
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.0000255
Further Details:      
 
Domain Number 2 Region: 131-202
Classification Level Classification E-value
Superfamily D-ribose-5-phosphate isomerase (RpiA), lid domain 1.31e-24
Family D-ribose-5-phosphate isomerase (RpiA), lid domain 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|501683266|ref|YP_008003092.1|
Sequence length 223
Comment ribose-5-phosphate isomerase A [Pseudomonas protegens CHA0]
Sequence
MTQDQLKQAVAQAAVDLILPKLDDKSIVGVGTGSTANCFIDALALHKGAFDGAVASSEAT
AARLKGHGIAVYELNTVSDLEFYIDGADESDEHLNLIKGGGAALTREKIVAAVAKTFICI
ADASKLVPVLGNFPLPVEVIPMARSHVARELVKLGGDPVYREGVITDNGNIILDVHNMQI
TNPVELESQINAIVGVVTNGLFAARPADVLLLGTAEGVKTLKA
Download sequence
Identical sequences A0A2C9EVS8
WP_015637403.1.27351 WP_015637403.1.48506 WP_015637403.1.76749 WP_015637403.1.88821 gi|501683266|ref|YP_008003092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]